1.67 Rating by CuteStat

drewmartens.com is 1 decade 2 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, drewmartens.com is SAFE to browse.

PageSpeed Score
42
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Drew Martens | Creative Perceptions

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 19
Google Adsense: Not Applicable Google Analytics: UA-0000000-0

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- erinappenzoller.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.4.5
Date: Sun, 02 Mar 2014 16:55:11 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://drewmartens.com/xmlrpc.php
Content-Encoding: gzip

Domain Information

Domain Registrar: Launchpad.com Inc.
Registration Date: Feb 25, 2014, 12:00 AM 1 decade 2 months 1 week ago
Last Modified: Feb 25, 2014, 12:00 AM 1 decade 2 months 1 week ago
Expiration Date: Feb 25, 2015, 12:00 AM 9 years 2 months 6 days ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns6489.hostgator.com 192.254.234.252 United States of America United States of America
ns6490.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
drewmartens.com A 14382 IP: 192.254.234.33
drewmartens.com NS 21599 Target: ns6490.hostgator.com
drewmartens.com NS 21599 Target: ns6489.hostgator.com
drewmartens.com SOA 21599 MNAME: ns6489.hostgator.com
RNAME: root.gator3245.hostgator.com
Serial: 2014022301
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
drewmartens.com MX 14399 Target: drewmartens.com
drewmartens.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: DREWMARTENS.COM
Registry Domain ID:
Registrar WHOIS Server: whois.launchpad.com
Registrar URL: LaunchPad.com
Updated Date: 25-Feb-2014
Creation Date: 25-Feb-2014
Registrar Registration Expiration Date: 25-Feb-2015
Registrar: Launchpad, Inc. (HostGator)
Registrar IANA ID: 955
Registrar Abuse Contact Email: abuse@websitewelcome.com
Registrar Abuse Contact Phone: +1.713-574-5287
Domain Status: clientTransferProhibited
Registry Registrant ID: HG_34369271
Registrant Name: Adam Farrar
Registrant Organization: None
Registrant Street: 11251 Northwest Fwy suite 400
Registrant City: Houston
Registrant State/Province: TX
Registrant Postal Code: 77092
Registrant Country: US
Registrant Phone: +1.7135745287
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: support@hostgator.com
Registry Admin ID: HG_34369272
Admin Name: Adam Farrar
Admin Organization: None
Admin Street: 11251 Northwest Fwy suite 400
Admin City: Houston
Admin State/Province: TX
Admin Postal Code: 77092
Admin Country: US
Admin Phone: +1.7135745287
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: support@hostgator.com
Registry Tech ID: HG_34369274
Tech Name: Adam Farrar
Tech Organization: None
Tech Street: 11251 Northwest Fwy suite 400
Tech City: Houston
Tech State/Province: TX
Tech Postal Code: 77092
Tech Country: US
Tech Phone: +1.7135745287
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: support@hostgator.com
Name Server: ns6489.hostgator.com
Name Server: ns6490.hostgator.com
DNSSEC:Unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>>Last update of WHOIS database: 2014-03-02T16:55:19+0000Z